- Discount up to 35% for first purchase only this month.
- contact@synergy-sciences.com
- 302-427-5880
$0.00
weight loss
All Orders ship same day if ordered before 1PM EST
Purity ≥ 98% HPLC verified
Your payments are secure with our private security network.
Purity: ≥98% (HPLC Verified)
Form: Lyophilized Powder
Molecular Formula: C213H327N55O64
Molecular Weight: 4812.47 g/mol
Storage: Store lyophilized vial in a cool, dry place. After reconstitution, store at 2–8°C and use within 30 days.
CAS Number: [Pending Public Release]
Retatrutide is a novel triple agonist peptide targeting GLP-1 (glucagon-like peptide-1), GIP (glucose-dependent insulinotropic polypeptide), and glucagon receptors. It is currently being studied for its effects on metabolic regulation, appetite modulation, and glucose homeostasis.
In preclinical and early clinical studies, Retatrutide has shown potential to significantly impact body weight, insulin sensitivity, and energy expenditure, making it a compound of interest in the study of obesity, Type 2 diabetes, and metabolic disorders.
Y-AEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-EGTFTSDVSSYLEGQAAKEFIAWLVKGRG-KNAAPECSE
Note: Synthetic peptide sequence may vary slightly by supplier batch.
This product is intended strictly for laboratory research use only. It is not for human consumption, medical, diagnostic, or therapeutic applications.
All compounds sold by Synergy Sciences, LLC are intended for qualified research professionals only. Retatrutide is supplied for in vitro laboratory research purposes only. It is not approved by the FDA, EMA, or any other regulatory agency for medical or therapeutic use.
Misuse of this product is strictly prohibited. The buyer is responsible for understanding and complying with all local regulations regarding research chemical handling and usage.
Ingredients
List each compound or ingredient used in the product, clearly and accurately.
Example: N-Acetyl L-Tyrosine, 99.5% pure (pharmaceutical grade), sourced from USA
Example: Noopept, ≥ 98% purity (lab tested), sourced from Europe
For each ingredient, specify:
Purity level (e.g., ≥ 98%, 99.9% pure, USP/Pharma grade)
Source/Country of origin (e.g., USA, Germany, Japan, verified supplier)
(Optional) Testing status or “lab tested” statement if you have Certificates of Analysis (COA) available
Lorem Ipsum is simply dummy text of the printing and typesetting industry. Lorem Ipsum has been the industry’s standard dummy text ever since the 1500s, when an unknown printer took a galley of type and scrambled it to make a type specimen book. It has survived not only five centuries, but also the leap into electronic typesetting, remaining essentially unchanged. It was popularised in the 1960s with the release of Letraset sheets containing Lorem Ipsum passages, and more recently with desktop publishing software like Aldus PageMaker including versions of Lorem Ipsum.
All products sold by Synergy Sciences are intended for laboratory research purposes only. They are not intended for human consumption or therapeutic use. By purchasing from this website, you acknowledge that you are a qualified researcher or purchaser who understands the risks and responsibilities involved in handling research chemicals. Misuse of any products sold on this site may result in legal consequences.
Sign-up to our newsletter to get updated information, news, insight and promotions.
