- Discount up to 35% for first purchase only this month.
- contact@synergy-sciences.com
- 302-427-5880
All Orders ship same day if ordered before 1PM EST
Purity ≥ 98% HPLC verified
Your payments are secure with our private security network.
Purity: ≥98% (HPLC Verified)
Form: Lyophilized Powder
Molecular Formula: C213H327N55O64
Molecular Weight: 4812.47 g/mol
Storage: Store lyophilized vial in a cool, dry place. After reconstitution, store at 2–8°C and use within 30 days.
CAS Number: [Pending Public Release]
Retatrutide is a novel triple agonist peptide targeting GLP-1 (glucagon-like peptide-1), GIP (glucose-dependent insulinotropic polypeptide), and glucagon receptors. It is currently being studied for its effects on metabolic regulation, appetite modulation, and glucose homeostasis.
In preclinical and early clinical studies, Retatrutide has shown potential to significantly impact body weight, insulin sensitivity, and energy expenditure, making it a compound of interest in the study of obesity, Type 2 diabetes, and metabolic disorders.
Y-AEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-EGTFTSDVSSYLEGQAAKEFIAWLVKGRG-KNAAPECSE
Note: Synthetic peptide sequence may vary slightly by supplier batch.
This product is intended strictly for laboratory research use only. It is not for human consumption, medical, diagnostic, or therapeutic applications.
All compounds sold by Synergy Sciences, LLC are intended for qualified research professionals only. Retatrutide is supplied for in vitro laboratory research purposes only. It is not approved by the FDA, EMA, or any other regulatory agency for medical or therapeutic use.
Misuse of this product is strictly prohibited. The buyer is responsible for understanding and complying with all local regulations regarding research chemical handling and usage.
Lorem ipsum dolor sit amet, consectetur adipiscing elit. Ut elit tellus, luctus nec ullamcorper mattis, pulvinar dapibus leo.
Lorem ipsum dolor sit amet, consectetur adipiscing elit. Ut elit tellus, luctus nec ullamcorper mattis, pulvinar dapibus leo.
All products sold by Synergy Sciences are intended strictly for laboratory research purposes only. They are not intended for human consumption, therapeutic use, or clinical applications. By purchasing from this website, you acknowledge that you are a qualified researcher or purchaser who understands the risks and responsibilities associated with handling research chemicals. Any misuse of products sold on this site may result in legal consequences.
Sign-up to our newsletter to get updated information, news, insight and promotions.