Purity: ≥98% (HPLC Verified)

Form: Lyophilized Powder

Molecular Formula: C213H327N55O64

Molecular Weight: 4812.47 g/mol

Storage: Store lyophilized vial in a cool, dry place. After reconstitution, store at 2–8°C and use within 30 days.

CAS Number: [Pending Public Release]

Description

Retatrutide is a novel triple agonist peptide targeting GLP-1 (glucagon-like peptide-1), GIP (glucose-dependent insulinotropic polypeptide), and glucagon receptors. It is currently being studied for its effects on metabolic regulation, appetite modulation, and glucose homeostasis.

In preclinical and early clinical studies, Retatrutide has shown potential to significantly impact body weight, insulin sensitivity, and energy expenditure, making it a compound of interest in the study of obesity, Type 2 diabetes, and metabolic disorders.

Sequence

Y-AEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-EGTFTSDVSSYLEGQAAKEFIAWLVKGRG-KNAAPECSE

Note: Synthetic peptide sequence may vary slightly by supplier batch.

Intended Use

This product is intended strictly for laboratory research use only. It is not for human consumption, medical, diagnostic, or therapeutic applications.

Product Inclusions

• 1 x 5 mg vial of Retatrutide (lyophilized powder)
• Tamper-evident seal
• Optional Certificate of Analysis (COA available upon request)

Disclaimer

All compounds sold by Synergy Sciences, LLC are intended for qualified research professionals only. Retatrutide is supplied for in vitro laboratory research purposes only. It is not approved by the FDA, EMA, or any other regulatory agency for medical or therapeutic use.

Misuse of this product is strictly prohibited. The buyer is responsible for understanding and complying with all local regulations regarding research chemical handling and usage.